PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_015710-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 362aa    MW: 40836.4 Da    PI: 8.1517
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_015710-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.26e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  AHYPO_015710-RA 14 KGLWSPEEDEKLFNHITRFGVGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding46.58.8e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +++ E++l++++++ lG++ W+ Ia+ ++ gRt++++k++w++
  AHYPO_015710-RA  67 RGMFSQVEEDLIINLHQILGNR-WAQIASQLP-GRTDNEIKNFWNS 110
                      7889******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.9E-25664IPR009057Homeodomain-like
PROSITE profilePS5129423.682965IPR017930Myb domain
SuperFamilySSF466899.73E-2911108IPR009057Homeodomain-like
SMARTSM007174.3E-121363IPR001005SANT/Myb domain
PfamPF002491.1E-131461IPR001005SANT/Myb domain
CDDcd001674.16E-101761No hitNo description
Gene3DG3DSA:1.10.10.606.7E-2565117IPR009057Homeodomain-like
PROSITE profilePS5129418.09566116IPR017930Myb domain
SMARTSM007171.7E-1366114IPR001005SANT/Myb domain
PfamPF002491.9E-1367111IPR001005SANT/Myb domain
CDDcd001671.01E-970109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MGRHSCCVKQ KLKKGLWSPE EDEKLFNHIT RFGVGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGMF SQVEEDLIIN LHQILGNRWA QIASQLPGRT DNEIKNFWNS CLKKKLIKQG  120
IDPQTHQPLS SKPQPKNTNT NTNTNNNNND NGFKSASENN KITRNVKIET SFPINNNNNN  180
VRASALISND WGRQNTTELS NTNASIFSSL LQQPASTFVG TSQSYLSLLR PMIESSHIQQ  240
YMDIQLPGCT NFNGNLEKEN MGSESLIFNE GKECSSSSNS NNNTSNIITS SISNNNGRFS  300
WDCQSENFQF PINYGGLIKM EEFSHDQTNS WDEQQIKSFS LPEDLVTTSG GNFDYFLQHI  360
S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678849.11e-140PREDICTED: transcription factor MYB86-like
TrEMBLA0A0K9RHI81e-119A0A0K9RHI8_SPIOL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.16e-79myb domain protein 86